*** BUZZ Profits - More Traffic, More Sales, More Fun - Let Me Show You The HONEY ***
 

 

sauravhiplclipholidayofindiabesttravelgurutraveldiggtechlokindiauktradeadobelearnbrowseicondiggdealsgetfreelinktripsafricatrainstickettripsflightstripshotelsskydealsflightstravelguru4ueasylifetravelplaceindiaokairtraveletopflightindiastriptravelerpointshotelsandticketsletsmakeatriptravel-salemytripofferscricketnext.usjoinunlimitedjoomlaindiaorbitztripsalesandmarketinggurustoregurutravelinfopediatripworldwidetourtriptravelbooktravel.usghumo.coflightraja.cotech2.comultimaptripwalatripwalatripwalagooglyx

Selling An Internet Business Questions

Other Stuff No Comments »

Another new feature at MidasCode.co.uk

Selling An Internet Business Questions

Feel free to drop by and ask your questions. Cannot always promise an answer - but if I can’t answer your question it is almost certain I will know a man / or woman who can ;-)

SEO Mentor and Domain Buzz

SEO No Comments »

A couple of new sites from MidasCode Ltd

SEO Mentor

Domainers Information and Domain Chat

MidasCode Ltd

Marketing Punk No Comments »

My new business and new website

We Buy Websites

I am now officially a buyer and fixerupper of websites - a sort of virtual property developer

Wish me luck ;-)

what is a domainer

Observations, Marketing Punk 1 Comment »

As some of you know - I do occasionally invest is some domains (usually generic domains) - sometimes to develop into websites and sometimes just as an “investment”

Of couse some of these “investments” are suspect and the old saying that something is only ever worth what someone else is willing to pay remains true - but I do know I am going to have a RESULT one day? (Please ! Please !)

Anyway for those of you who may be interested in this “domaining thing” - the following websites explain more:

Masters of their Domains

The New Cybersquatters

You might be a domainer if…

1. When somebody on TV makes up a phrase you check to see if the .com is available.
2. When you type in a URL and get a 404, you check the Whois.
3. You own your own personal name as a .com. (thats me!)
4. You own your own personal name as multiple extensions.
5. You don’t know what GOOG is trading at, but you know the highest reported domain sale of last week.
6. You were involved in the highest reported domain sale of last week.
7. You have more domains than friends.
8. You purposely leave the .net available for registration so some sucker will develop it and indirectly send traffic to your .com of the same name.
9. You register the .com as well as the .net, and then sell the .net without mentioning that you also own the .com, for reasons stated in #8.
10. You have spent enough money on domains to buy a nice house. (Or two)

CREDIT: My friend Joe of Sundaybrew Media referred me to a posting with the above 10 suggestions - which were originally posted by his friend Andrew at a discussion at the DNForum called You might be a domainer if

It really is an excellent read - and it also features many more suggestions that the 10 above ;-)

Also worth a read: You might NOT be a domainer if

WP Theme & Icons by N.Design Studio
Entries RSS Comments RSS Login


Barry Dunlop Internet Lead Generation Expert | Make Money Online