*** BUZZ Profits - More Traffic, More Sales, More Fun - Let Me Show You The HONEY ***
 

 

sauravhiplclipholidayofindiabesttravelgurutraveldiggtechlokindiauktradeadobelearnbrowseicondiggdealsgetfreelinktripsafricatrainstickettripsflightstripshotelsskydealsflightstravelguru4ueasylifetravelplaceindiaokairtraveletopflightindiastriptravelerpointshotelsandticketsletsmakeatriptravel-salemytripofferscricketnext.usjoinunlimitedjoomlaindiaorbitztripsalesandmarketinggurustoregurutravelinfopediatripworldwidetourtriptravelbooktravel.usghumo.coflightraja.cotech2.comultimaptripwalatripwalatripwalagooglyx

A Brief History of Medicine

Observations No Comments »

I say this today - and it quite amused me - not sure about the date order - but the “theory” is good

Once again - an fine example of the CYCLE of LIFE - THE CYCLE of BUSINESS

A Brief History of Medicine:

‘Doctor, I have an ear ache.’

2000 BC - ‘Here, eat this root.’

1000 BC - ‘That root is heathen, say this prayer.’

1800 AD - ‘That prayer is superstition, drink this potion’

1940 AD - ‘That potion is snake oil, swallow this pill.’

1985 AD - ‘That pill is ineffective, take this antibiotic.’

2007 AD - ‘That antibiotic is artificial. Here, eat this root!’

Shift Happens Video | Must Watch Video For Any Serious Entrepreneur

Other Stuff 1 Comment »

Shift Happens Video | Must Watch Video For Any Serious Entrepreneur

This is one of the most popular videos on YouTube - with Views of 2,336,011 at the time of my post

The Did You Know Presentation - Shift Happens - Globalization and The Information Age

Created by Karl Fisch, and modified by Scott McLeod; Globalization and The Information Age

Domain Name Help | Signs That You Are A Domainer

Observations No Comments »

Domain Name Help | Signs That You Are A Domainer

Back in 2006 I did a post called what is a domainer

I thought it quite interesting and funny at the time, but Rudy Hernandez has just sent me details of an updated list.

For those of us who just can’t stop buying domain names this is quite funny. It might also be a sign that we should seek help ;-)

Rudys post is at:
You Might Be A Domainer If…

Some of the clever additions to the list of “You Might Be A Domainer If” are:

… your Sedo rep sends you holiday cards.

… you can recite GoDaddy promo codes from memory.

… you consider parking nothing to do with an automobile.

…you have a bracelet that says “What would Frank Schilling Do?”

ENJOY and Thank You Rudy!

My Viral Marketing Lesson

Marketing Punk 1 Comment »

Viral Marketing Lesson

What can I say?

This one really surprised me - Dean Hunt made a post at Streetlessons.com - which was “just” an image of an unusual clock - a Clock for Nerds as Dean put it.

If I am honest - it was for want of a better word a “filler” post.

But the thing is, that single post has brought over 25000 visitors to Streetlessons.com in just 12 hrs yesterday - such is the power of DIGG etc

Just goes to show - you can never predict what will catch peoples imagination - or put another way - one should not allow ones own lack of Intellect to stand in the way of a GREAT POST!

See the Post Here: The Perfect Clock for NERDS

Funny Domain Names With Accidental Double Meanings

Conservatories No Comments »

Finding a good domain name can be hard enough, but now we have to worry about accidental double meanings.

For example: ExpertsExchange.com COULD ALSO BE ExpertSexchange.com

Check it Out - Funny Domain Names With Accidental Double Meanings

Something else to think about when looking for a Domain Name!!

Read The Whole Story Here | digg story

WP Theme & Icons by N.Design Studio
Entries RSS Comments RSS Login


Barry Dunlop Internet Lead Generation Expert | Make Money Online