>> Let Me Give You A Web Traffic Orgasm - FREE Report - Click Here <<
 

 

sauravhiplclipholidayofindiabesttravelgurutraveldiggtechlokindiauktradeadobelearnbrowseicondiggdealsgetfreelinktripsafricatrainstickettripsflightstripshotelsskydealsflightstravelguru4ueasylifetravelplaceindiaokairtraveletopflightindiastriptravelerpointshotelsandticketsletsmakeatriptravel-salemytripofferscricketnext.usjoinunlimitedjoomlaindiaorbitztripsalesandmarketinggurustoregurutravelinfopediatripworldwidetourtriptravelbooktravel.usghumo.coflightraja.cotech2.comultimaptripwalatripwalatripwalagooglyx

SEO Tools

SEO No Comments »

SEO Tools - Keyword Density - Search Term Suggestion Tool - Free Broken Link Checker

I am always being asked where do you find a Web Application / SEO Tool to do this job or that when it comes to analyzing a website or web page.

I have of course got my favourites - but today I found what I consider the best SEO GOLDMINE of the lot. It claims to have 136 SEO Tools - but I have not counted them.

Check it out at: SEO Tools

This SEO Tools page has links to the best SEO Tools on the internet and these tools will help you to optimize your website and move your search engine position higher.

Not all the tools work - or at least not in my experience using IE7 - but some pretty useful ones - Go check it out

SEO Mentor and Domain Buzz

SEO No Comments »

A couple of new sites from MidasCode Ltd

SEO Mentor

Domainers Information and Domain Chat

If it’s too good to be true it probably is

SEO No Comments »

Great article from the online version of Telegraph.co.uk - about the risks business owners run when they buy SEO services.

this is highly recommended reading - Buyer Beware!

If it’s too good to be true, it probably is

Barry Dunlop

Double Glazing -, Home Improvements, PPC, SEO, Other Stuff, Observations, Consultancy, Google, Affiliate Marketing 1 Comment »

Barry Dunlop is Founder of Ebuilders Ltd - owners of a portfolio of highly successful Portal Style websites that feature home improvements products, including: conservatories, double glazing, kitchens, garage doors, awnings, conservatory blinds and bathrooms. Their portfolio of sites include the market leading website: Conservatories and Sunrooms Online , a website which enables users to research, amongst other things, styles, materials and types of conservatory construction plus obtain brochures / quotations or find suppliers in their local area.

In 2006 Barry sold a controlling interest in Ebuilders Ltd and while he still has a small amount of involvement with Ebuilders he has decided that his next online business model will be as a “fixer-upper” of websites – a sort of online Virtual Property Development Business that in addition to developing it’s own websites will also buy and re-sell websites. This business is called: MidasCode Ltd

Barrys other interests include: Self Help, Walking, Entrepreneurship and being father to four teenage children.

Barry Dunlop

CSS Link Specificity By Nicole Hernandez

SEO No Comments »

Love Hate is how I taught myself to remember the order. The acronym for the order (LVHA) just wasn’t terribly easy to remember on its own. It didn’t spell anything, or really give a sensical meaning to me. But Love Hate works. So what is LVHA?

1. a:link
2. a:visited
3. a:hover
4. a:active

LVHA is the order you should designate your link rules in the CSS so they work together. The way that it is designed to work in CSS, each selector has a specificity. So, just like anything else in the cascade, if there are two selectors that are both applied to one element, the one with the higher specificity is applied. Put them in the wrong order, and you could end up with a page that isn’t showing your style rules as you intended them.

The only two that you can change the order on are the a:link and a:visited (primarily because a link is only either or, never both). Now, keep in mind that you can change a multidute of things with links, but always keep in mind that specificity. To give an example of a potential problem, look at the following CSS:

Problem Order

a:link { background-color:white; color: blue }
a:active { background-color: blue; color: white;}
a:hover { background-color: black; color: white;}
a:visited {background-color:white; color:green;}

If you use the above CSS, all of it will work Except the active rules. Those will not show. Why? As I said earlier, visited and link do not have to be in a specific order (though ideally they should be in the LVHA order to keep consistency), but the active has to come after the hover. Due to the active being placed before the hover, that part breaks. Simply swapping the places of the active and hover (within the CSS) will fix the order of the cascade and allow it to all work.

Correct Order

a:link { background-color:white; color: blue }
a:hover { background-color: black; color: white;}
a:active { background-color: blue; color: white;}
a:visited {background-color:white; color:green;}

In CSS2 we were able to combine our pseudo-classes, so that we could customize it further. An example being that you could have a regular hover for a link, but make it different for a visited link:

a:visited:hover {background-color: green; color: black;}

Overall, as long as you remember Love Hate, specificity for making links isn’t terribly complicated.

Nicole Hernandez is a web developer with a specialty in web standards and accessibility. She is the owner of Website Style and publishes technical articles on her blog called Beyond Caffeine .

Article Source: http://EzineArticles.com/?expert=Nicole_Hernandez

WP Theme & Icons by N.Design Studio
Entries RSS Comments RSS Login


Barry Dunlop Internet Lead Generation Expert | Make Money Online