>> Let Me Give You A Web Traffic Orgasm - FREE Report - Click Here <<
 

 

sauravhiplclipholidayofindiabesttravelgurutraveldiggtechlokindiauktradeadobelearnbrowseicondiggdealsgetfreelinktripsafricatrainstickettripsflightstripshotelsskydealsflightstravelguru4ueasylifetravelplaceindiaokairtraveletopflightindiastriptravelerpointshotelsandticketsletsmakeatriptravel-salemytripofferscricketnext.usjoinunlimitedjoomlaindiaorbitztripsalesandmarketinggurustoregurutravelinfopediatripworldwidetourtriptravelbooktravel.usghumo.coflightraja.cotech2.comultimaptripwalatripwalatripwalagooglyx

Domain Name Help | Signs That You Are A Domainer

Observations Add comments

Domain Name Help | Signs That You Are A Domainer

Back in 2006 I did a post called what is a domainer

I thought it quite interesting and funny at the time, but Rudy Hernandez has just sent me details of an updated list.

For those of us who just can’t stop buying domain names this is quite funny. It might also be a sign that we should seek help ;-)

Rudys post is at:
You Might Be A Domainer If…

Some of the clever additions to the list of “You Might Be A Domainer If” are:

… your Sedo rep sends you holiday cards.

… you can recite GoDaddy promo codes from memory.

… you consider parking nothing to do with an automobile.

…you have a bracelet that says “What would Frank Schilling Do?”

ENJOY and Thank You Rudy!

Leave a Reply

WP Theme & Icons by N.Design Studio
Entries RSS Comments RSS Login


Barry Dunlop Internet Lead Generation Expert | Make Money Online