>> Let Me Give You A Web Traffic Orgasm - FREE Report - Click Here <<
 

 

sauravhiplclipholidayofindiabesttravelgurutraveldiggtechlokindiauktradeadobelearnbrowseicondiggdealsgetfreelinktripsafricatrainstickettripsflightstripshotelsskydealsflightstravelguru4ueasylifetravelplaceindiaokairtraveletopflightindiastriptravelerpointshotelsandticketsletsmakeatriptravel-salemytripofferscricketnext.usjoinunlimitedjoomlaindiaorbitztripsalesandmarketinggurustoregurutravelinfopediatripworldwidetourtriptravelbooktravel.usghumo.coflightraja.cotech2.comultimaptripwalatripwalatripwalagooglyx

A system puts you in control of your life | New Year Resolutions

Other Stuff 1 Comment »

To my dear, wonderful, beautiful Children

Its that time of year again - and here is some advice I wish someone had gave me when I was your ages

12 Practical Ways for SELF-IMPROVEMENT this NEW Year

Please read them all - but in particular…..

#4. Establish a personal system using manila folders and labels. Label a folder personal and put in your important documents such as passports, diplomas. Keep a folder for credit card bills, bank statements, taxes, insurance and work documents. A system puts you in control of your life.

love

Dad X

Cycle India 2008, Charity Bike Ride, Sponsored By BarryDunlop.com

Other Stuff 1 Comment »

Barry Dunlop Sponsors - Cycle India 2008

It is every man’s obligation to put back into the world at
least the equivalent of what he takes out of it ~ Albert Einstein

On 2nd January 2008, Heal has 25 UK cyclists flying to Hyderabad to take part in Cycle India. This is Heal’s biggest fundraising effort to date with the hope that we will raise in the region of £100,000 which will go towards building a new school project in Andhra Pradesh.

cycle india

L to R - Photo shows Matthew Glover (head of Fund Raising), Dr Prasad (the founder of Heal) and Barry Dunlop.

Heal is a UK registered charity which raises money for helping orphaned and underprivileged children escape from poverty in this region of India. I am passionate about Heal as virtually all the money we raise goes directly to helping these kids, as the charity has virtually no administration costs with no paid staff.

So far, Cycle India has already raised over £75,000 and we hope the final total will be over £100,000! With this revenue, which is a massive amount for a small charity, HEAL intends to invest in a new project, such as a new school or further Children’s Village.

For more information about Heal, please visit www.heal.co.uk

“Giving is better than receiving because giving starts the receiving process.” – Jim Rohn

Al Pacino and Developing a Positive Mental Attitude

Direct Sales No Comments »

Al Pacino and Developing a Positive Mental Attitude

Dean Hunt made a great / fun post at StreetLessons.com - Steve Jobs vs Al Pacino - The Battle of Inspiration which alerted me to the following video.

Can’t really explain why - but something about reminds me of Monday Morning sales meetings in my early days as a young / rookie Double Glazing salesman. I was fortunate enough to have a sales manager (Keith Revel) who seemed to have this remarkable ability to get us to reach deep down inside ourselves and find some latent talent that we never knew we had - which allowed us to better and better our sales results every week.

Thank You Keith - Thank you Al Pacino

I just love this amazing quote from Al Pacino / Tony D’Amato:

You find out life’s this game of inches, so is football. Because in either game - life or football - the margin for error is so small. I mean, one half a step too late or too early and you don’t quite make it. One half second too slow, too fast and you don’t quite catch it. The inches we need are everywhere around us. They’re in every break of the game, every minute, every second. On this team we fight for that inch. On this team we tear ourselves and everyone else around us to pieces for that inch. We claw with our fingernails for that inch. Because we know when add up all those inches, that’s gonna make the fucking difference between winning and losing! Between living and dying!

From the 1999 Movie - Any Given Sunday

The Richter Scales - Here Comes Another Bubble

Other Stuff 1 Comment »

My son Michael tipped me of about the YouTube video - really quite clever and for sure, a Statement of our times - Enjoy?

The Web 2.0 “bubble” had it coming. A Silicon Valley music video by the Richter Scales

A Brief History of Medicine

Observations No Comments »

I say this today - and it quite amused me - not sure about the date order - but the “theory” is good

Once again - an fine example of the CYCLE of LIFE - THE CYCLE of BUSINESS

A Brief History of Medicine:

‘Doctor, I have an ear ache.’

2000 BC - ‘Here, eat this root.’

1000 BC - ‘That root is heathen, say this prayer.’

1800 AD - ‘That prayer is superstition, drink this potion’

1940 AD - ‘That potion is snake oil, swallow this pill.’

1985 AD - ‘That pill is ineffective, take this antibiotic.’

2007 AD - ‘That antibiotic is artificial. Here, eat this root!’

Shift Happens Video | Must Watch Video For Any Serious Entrepreneur

Other Stuff 1 Comment »

Shift Happens Video | Must Watch Video For Any Serious Entrepreneur

This is one of the most popular videos on YouTube - with Views of 2,336,011 at the time of my post

The Did You Know Presentation - Shift Happens - Globalization and The Information Age

Created by Karl Fisch, and modified by Scott McLeod; Globalization and The Information Age

Domain Name Help | Signs That You Are A Domainer

Observations No Comments »

Domain Name Help | Signs That You Are A Domainer

Back in 2006 I did a post called what is a domainer

I thought it quite interesting and funny at the time, but Rudy Hernandez has just sent me details of an updated list.

For those of us who just can’t stop buying domain names this is quite funny. It might also be a sign that we should seek help ;-)

Rudys post is at:
You Might Be A Domainer If…

Some of the clever additions to the list of “You Might Be A Domainer If” are:

… your Sedo rep sends you holiday cards.

… you can recite GoDaddy promo codes from memory.

… you consider parking nothing to do with an automobile.

…you have a bracelet that says “What would Frank Schilling Do?”

ENJOY and Thank You Rudy!

My Viral Marketing Lesson

Marketing Punk 1 Comment »

Viral Marketing Lesson

What can I say?

This one really surprised me - Dean Hunt made a post at Streetlessons.com - which was “just” an image of an unusual clock - a Clock for Nerds as Dean put it.

If I am honest - it was for want of a better word a “filler” post.

But the thing is, that single post has brought over 25000 visitors to Streetlessons.com in just 12 hrs yesterday - such is the power of DIGG etc

Just goes to show - you can never predict what will catch peoples imagination - or put another way - one should not allow ones own lack of Intellect to stand in the way of a GREAT POST!

See the Post Here: The Perfect Clock for NERDS

Funny Domain Names With Accidental Double Meanings

Conservatories No Comments »

Finding a good domain name can be hard enough, but now we have to worry about accidental double meanings.

For example: ExpertsExchange.com COULD ALSO BE ExpertSexchange.com

Check it Out - Funny Domain Names With Accidental Double Meanings

Something else to think about when looking for a Domain Name!!

Read The Whole Story Here | digg story

TV Style Web Adverts From West Yorkshire Windows

Conservatories, Double Glazing - No Comments »

TV Style Web Adverts From West Yorkshire Windows

Any one who knows me - knows that I believe passionately in Web Video - and here is a fine example of one UK replacement window company who is now producing their own “T V Adverts” style WEB ADVERTS - West Yorkshire Windows

Not quite SafeStyle UK or even a BOGOF offer - but lets face it “these deals can’t last forever” ;-)

About The Video

Andrew Glover tells us of the latest offers from West Yorkshire Windows.

For more information about West Yorkshire Windows try the website http://www.westyorkshirewindows.com

WP Theme & Icons by N.Design Studio
Entries RSS Comments RSS Login


Barry Dunlop Internet Lead Generation Expert | Make Money Online