*** BUZZ Profits - More Traffic, More Sales, More Fun - Let Me Show You The HONEY ***
 

 

sauravhiplclipholidayofindiabesttravelgurutraveldiggtechlokindiauktradeadobelearnbrowseicondiggdealsgetfreelinktripsafricatrainstickettripsflightstripshotelsskydealsflightstravelguru4ueasylifetravelplaceindiaokairtraveletopflightindiastriptravelerpointshotelsandticketsletsmakeatriptravel-salemytripofferscricketnext.usjoinunlimitedjoomlaindiaorbitztripsalesandmarketinggurustoregurutravelinfopediatripworldwidetourtriptravelbooktravel.usghumo.coflightraja.cotech2.comultimaptripwalatripwalatripwalagooglyx

Domain Name Help | Signs That You Are A Domainer

Observations No Comments »

Domain Name Help | Signs That You Are A Domainer

Back in 2006 I did a post called what is a domainer

I thought it quite interesting and funny at the time, but Rudy Hernandez has just sent me details of an updated list.

For those of us who just can’t stop buying domain names this is quite funny. It might also be a sign that we should seek help ;-)

Rudys post is at:
You Might Be A Domainer If…

Some of the clever additions to the list of “You Might Be A Domainer If” are:

… your Sedo rep sends you holiday cards.

… you can recite GoDaddy promo codes from memory.

… you consider parking nothing to do with an automobile.

…you have a bracelet that says “What would Frank Schilling Do?”

ENJOY and Thank You Rudy!

My Viral Marketing Lesson

Marketing Punk 1 Comment »

Viral Marketing Lesson

What can I say?

This one really surprised me - Dean Hunt made a post at Streetlessons.com - which was “just” an image of an unusual clock - a Clock for Nerds as Dean put it.

If I am honest - it was for want of a better word a “filler” post.

But the thing is, that single post has brought over 25000 visitors to Streetlessons.com in just 12 hrs yesterday - such is the power of DIGG etc

Just goes to show - you can never predict what will catch peoples imagination - or put another way - one should not allow ones own lack of Intellect to stand in the way of a GREAT POST!

See the Post Here: The Perfect Clock for NERDS

Funny Domain Names With Accidental Double Meanings

Conservatories No Comments »

Finding a good domain name can be hard enough, but now we have to worry about accidental double meanings.

For example: ExpertsExchange.com COULD ALSO BE ExpertSexchange.com

Check it Out - Funny Domain Names With Accidental Double Meanings

Something else to think about when looking for a Domain Name!!

Read The Whole Story Here | digg story

TV Style Web Adverts From West Yorkshire Windows

Conservatories, Double Glazing - No Comments »

TV Style Web Adverts From West Yorkshire Windows

Any one who knows me - knows that I believe passionately in Web Video - and here is a fine example of one UK replacement window company who is now producing their own “T V Adverts” style WEB ADVERTS - West Yorkshire Windows

Not quite SafeStyle UK or even a BOGOF offer - but lets face it “these deals can’t last forever” ;-)

About The Video

Andrew Glover tells us of the latest offers from West Yorkshire Windows.

For more information about West Yorkshire Windows try the website http://www.westyorkshirewindows.com

Small Job Plumber | Excellent Example of Niche Marketing For Home Improvements

Home Improvements No Comments »

Small Job Plumber | Excellent Example of Niche Marketing For Home Improvements

Spotted this the other day - an excellent example of a Plumber who understands the benefits of Niche Marketing

How many times have you wanted a small plumbing job done around the home - but when you look to find a plumber, they all look over qualified and Too Expensive to repair a leaking tap. Well now you need not worry - because there is at least one plumber in the world who takes on small jobs.

And my bet is that he does rather well at it!

small job plumber

Small Job Plumber | Excellent Example of Niche Marketing For Home Improvements

PS: Camera Phone Image - so not as clear as I would like..

Getting More Cash Out Of Internet Sales Leads | Essential Tips For Home Improvement Sales People

Direct Sales 2 Comments »

Getting More Cash Out Of Internet Sales Leads | Essential Tips For Home Improvement Sales People

Fresh of the Press - a new Sales Guide authored by Barry Dunlop and Sponsored By Ebuilders Ltd

Straight-Talking Internet Net Lead Generation Guide Reveals Secrets to Converting Internet Leads like a Pro

THE PRO'S GUIDE TO CONVERTING INTERNET SALES LEADS

Just a Few Of the Points The Internet Leads Guide Covers are:

· The Brutal Truth about the Internet (not for the faint hearted)

· Straight Talking Advice to convert like a Pro

· The Hidden Google Hack that will help you build rapport faster than a Brazilian Romeo

· How to Sell a Search

· How to Get Blood from a Stone – a Guide to getting the most from an Internet Lead.

· Learn how to respond to a lead whilst you sleep

· Why 60% of dealers slit their own wrists, and how you can avoid this killer mistake.

· Sales strategies to magically convert a con to a pro

· How to take a sneak peak into your client’s closet

· The secrets of a self confessed Internet Sleuth

· Why keywords are the key to unlocking your client’s motivation.

· My top tip for Internet Lead Mastery

· My Special Tip for Sales Managers (Top Secret)

· How Web Exploration Leads to Profits

Request your free download at:

Confessions Of A Saleman

Randy Pausch, Dying 47 year old Professor gives Exuberant Last Lecture | Must Watch Video

Mind, Body, Spirit 1 Comment »

Randy Pausch, Dying 47-year-old Professor gives Exuberant Last Lecture | Must Watch Video

I have just watched this video - Watch it - you will be glad you did.

Personal Note: I like to think I’m a tough guy but at the end of this video there was the glisten of a tear in my eye - but not with sadness - it was with immense pride and gratefullness to share my time on Earth with people of the calibre of Randy Pausch

Here are some quotes from the Randy Pausch Transcript - and this quote from the transcript impressed me most of all:

“If I don’t seem as depressed or morose as I should be, sorry to disappoint you.”

And Randy Pausch has some amazing things to say about Childhood Dreams:

“Almost all of us have childhood dreams; for example, being an astronaut, or making movies or video games for a living. Sadly, most people don�t achieve theirs, and I think that�s a shame. I had several specific childhood dreams, and I�ve actually achieved most of them. More importantly, I have found ways, in particular the creation (with Don Marinelli), of CMU�s Entertainment Technology Center of helping many young people actually Achieve their childhood dreams.”

We salute you Randy Pausch

Mark Anastasi and Ben Lowrey : Money and Products

Mind, Body, Spirit No Comments »

Ben Lowrey : Money and Products

These videos was forwarded to me today by Mark Anastasi - I strongly recommend you watch both of them. Sound quality is not that great in places but the message is awesome.

Great videos on the nature of money, the law of attraction and being in the ABUNDANCE ENERGY. These guys are clearly doing well for themselves - but most of all note their attitudes, their beliefs, especially the GRATITUDE they show.

Yes, I know the video is a bit of a Pitch for Ben Lowrey and Mark Anastasi for their Systems - but that doesn’t change the fact that the message is spot on!

And another…..

Mark Anastasi and Ben Lowrey in discussion

SEO Tools

SEO No Comments »

SEO Tools - Keyword Density - Search Term Suggestion Tool - Free Broken Link Checker

I am always being asked where do you find a Web Application / SEO Tool to do this job or that when it comes to analyzing a website or web page.

I have of course got my favourites - but today I found what I consider the best SEO GOLDMINE of the lot. It claims to have 136 SEO Tools - but I have not counted them.

Check it out at: SEO Tools

This SEO Tools page has links to the best SEO Tools on the internet and these tools will help you to optimize your website and move your search engine position higher.

Not all the tools work - or at least not in my experience using IE7 - but some pretty useful ones - Go check it out

I Am a Salesman

Direct Sales 4 Comments »

I Am a Salesman

Back in the early 80’s I produced an Audio Programme called: Super Selling. Today, for the first time in years I was reviewing the transcript from this audio programme and way at the back of the file, along with some other ‘positive sales quotes’ I found the following I am a Salesman MESSAGE. Obviously it appealed to me at the time ;-)

Perhaps a little dated today - but in an age when many sales people like to say they are in ‘marketing’ rather than ever admit they are sales people it is very much worth a read - if for no other reason than the fact that this is I suppose now a Historical Document.

It says: AUTHOR UNKNOWN - but if anyone out there knows who the Author is, please let me know.

I Am a Salesman

I am proud to be a salesman because more than any other man, I and millions of others like me, built a better world.

The man who builds a better mousetrap - or a better anything - would starve to death if he waited for people to beat a pathway to his door. Regardless of how good, or how needed, the product or service might be, it has to be sold.

“Eli Whitney was laughed at when he showed his cotton gin. Edison had
to install his electric light free of charge in an office building before anyone would even look at it. The first sewing machine was smashed to pieces by a Boston mob. , People scoffed at the idea of railroads. They thought that even travelling thirty miles an hour would stop the circulation of the blood! McCormick strived for fourteen years to get people to use his reaper. Westinghouse was considered a fool for stating that he could stop a train with wind. Morse had to plead before ten Congresses before they would even look at his telegraph.

The public didn’t go around demanding these things; they had to be sold!

They needed thousands of salesmen, trailblazers, pioneers, people who could persuade with the same effectiveness as the inventor could invent. Salesmen took these inventions, sold the public on what these products could do, taught customers how to use them, and then taught businessmen how to make a profit from them.”

As a salesman I’ve done more to the world what it is today than any other person you know. I was just as vital in your great-great grandfather’s day as I am in yours, and I’ll be just as vital in your great-great-grandson’s day. I have educated more people; created more jobs; taken more drudgery from the labourer’s work; given more profits to businessmen; and have given more people a fuller and richer life than anyone in history. I’ve dragged prices down, pushed quality up, ‘and made it possible for you to enjoy the comforts and luxuries of cars, radios, electric refrigerators, televisions, and double glazed homes and buildings. I’ve healed the sick, given security to the aged, and put thousands of young men and women through college. I’ve made it possible for inventors to invent, for factories to hum, and for ships to sail the seven seas.

How much money you find in your pay envelope next week, and whether in the future you will enjoy the luxuries of pre-fabricated homes, stratospheric flying airplanes, and a new world of jet propulsion and atomic power, depends on me. The loaf of bread that you bought today was on a baker’s shelf because I made sure that a farmer’s wheat got to a mill, that the mill made the wheat into flour, and that the flour was delivered to your baker.

Without me the wheels of industry would come to a grinding halt. And with that, jobs, marriages, politics, and freedom of thought would be a thing of the past. I AM A SALESMAN and I’m both proud and grateful that as such I serve my family, my fellow man, and my country.

AUTHOR UNKNOWN

Also see: Confessions Of A Salesman

WP Theme & Icons by N.Design Studio
Entries RSS Comments RSS Login


Barry Dunlop Internet Lead Generation Expert | Make Money Online